Ly61 |
Ly6.2 |
KKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPY |
||
[Ly62(+), Ly62(-)]
[lymphocyte antigen 62] This murine cell surface antigen is identical with CD40L [CD40 ligand], which is identical with TRAP [TNF-related activation protein], IMD3 [immunodeficiency with hyper-IgM immunodeficiency 3], T-BAM, CD154.
For additional information on CD antigens see also: CD antigens Dictionary.
See remarks in the CD antigens Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |