COPE Media Kit

Cope Home
Previous entry:
luminal cholecystokinin releasing factor
Next entry:
Random entry:
Search COPE:


This peptide of 43 amino acids (SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD) has been isolated from soybean. The protein contains an RGD cell adhesion motif and a conserved region of chromatin-binding proteins (Odani et al, 1987). The protein is encoded by the cotyledon-specific 2S albumin gene (Gm2S-1 protein) (Galvez and de Lumen, 1999).

Lunasin has been shown to prevent cellular transformation by chemical carcinogens and viral oncogenes (Hernández-Ledesma et al, 2009; Galvez et al, 2001; Jeong et al, 2002; Lam et al, 2003) and can inhibit the growth of breast (Hsieh et al, 2010; Hsieh et al, 2010; Pabona et al, 2013), leukemia (De Mejia et al, 2010), colon (Dia and Mejia, 2010), and lung cancer (Inaba et al, 2014) ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=31306