luminal cholecystokinin releasing factor |
Lunatusin |
preantral granulosa cells |
||
This peptide of 43 amino acids (SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD) has been isolated from soybean. The protein contains an RGD cell adhesion motif and a conserved region of chromatin-binding proteins (Odani et al, 1987). The protein is encoded by the cotyledon-specific 2S albumin gene (Gm2S-1 protein) (Galvez and de Lumen, 1999).
Lunasin has been shown to prevent cellular transformation by chemical carcinogens and viral oncogenes (Hernández-Ledesma et al, 2009; Galvez et al, 2001; Jeong et al, 2002; Lam et al, 2003) and can inhibit the growth of breast (Hsieh et al, 2010; Hsieh et al, 2010; Pabona et al, 2013), leukemia (De Mejia et al, 2010), colon (Dia and Mejia, 2010), and lung cancer (Inaba et al, 2014)
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |