LRG |
LRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR |
TGF-beta-2 latency-associated peptide |
||
(approved gene symbol) [leucine-rich alpha-2-glycoprotein 1] abbr. also LRG [leucine-rich alpha-2-glycoprotein]. The sequence of this protein of approximately 50 kDa (containing 23 % carbohydrate by weight) has been described by Takahashi et al (1985). The protein was isolated originally from human serum and termed leucine-rich 3.1-S-alpha2-glycoprotein (Haupt and Baudner, 1977). LRG1 is characterized by the presence of leucine-rich repeats. Saito et al (2002) have identified LRHG [leucine-rich HEV glycoprotein] in endothelial cells from high endothelial venules, which is thought to be the mouse counterpart of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |