COPE Media Kit


Cope Home
Previous entry:
LAMC1(139-150)
Next entry:
LA-MCP-4
Random entry:
QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKS
Search COPE:

LAM cells

[LAM cell]

[lymphangioleiomyomatosis cells] These cells are a prominent histologic feature in patients with lymphangioleiomyomatosis, a rare disorder that affects primarily women of child-bearing age. It is characterized by cystic lung destruction, abdominal tumors, and infiltration of the axial lymphatics in the thorax and abdomen (Johnson and Tattersfield, 2002; Taveira-DaSilva et al, 2006).

Lam cells are found in pulmonary and extrapulmonary lesions and are morphologically heterogeneous cells resembling smooth muscle cells (Fukuda et al, 1990; Ferrans et al, 2000). Extrapulmonary LAM cells in the lymphatics are arranged in fascicular and papillary patterns, and are commonly present in lymph nodes of the mediastinum and retroperitoneum (Matsui et al, 2000). LAM cells have been identified also in blood and other ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2011



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=29572