COPE Media Kit

Cope Home
Previous entry:
kalinin B2
Next entry:
kaliuretic hormone
Random entry:
MMP-2
Search COPE:

Kaliocin-1

Kaliocin-1 is a synthetic peptide of 31 amino acids (FFSASCVPGADKGQFPNLCRLCAGTGENKCA). The Lactoferrin(152-182) sequence is based on homologies common to all members of the transferrin family proteins (positions 152-182 of human lactoferrin). Kaliocin-1 has fungicidal activity against Candida spp., including fluconazole- and amphotericin B-resistant clinical isolates (Viejo-Diaz et al, 2005). Kaliocin-1, and lactoferrin show a bactericidal effect at low-ionic-strength conditions. The antimicrobial effect of kaliocin-1 is lower than that of human lactoferrin. The peptide also mimics native lactoferrin ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2006


 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE   |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R


cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=28315