IFN-tau-11 |
IFNW |
fowlicidins |
||
This bioactive fragment (EKGYSDCAWEIVRVEMMRALTSSTTLQKRLTKTGGDLNSP) is derived from the C-terminus of ovine IFN-tau and functions intracellularly as an IFN-mimetic (Ahmed and Johnson, 2014). For the purpose of gaining entry across the plasma membrane the sequence has been modified by attachment of a palmitic acid residue attached to the N-terminus.
The IFN-mimetic has been shown to inhibit melanoma cell proliferation in cell culture and also shows significant protection against lethal B16 melanoma in C57BL/6 mice. It is also a potent therapeutic against experimental allergic encephalomyelitis, a mouse model of multiple sclerosis but lacks the toxic side effects of the parent interferon
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |