Gallinacin-14 |
Gallopavin-1 |
Xenopus laevis mesoderm inducing factors |
||
Gallinacins are antimicrobial peptides isolated from chicken leukocytes that are the chicken counterparts of Beta-Defensins.
Gallinacin-1 (abbr. Gal 1; known also as CHP 1, [chicken heterophil peptide 1]) (GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW), Gallinacin-1-alpha (GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW), which in databanks is being referred to as CHP 2 [chicken heterophil peptide 2], and Gallinacin-2 (abbr. Gal 2) (LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |