facultative stem cells |
FADD-DN |
QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW |
||
[FAS-associated death domain protein] This protein is called also MORT-1. Serine-phosphorylated forms have been identified independently as CAP1 AND CAP2. The term FADD-DN in which DN stands for 'dominant negative' is a truncated form of the protein
FADD is a 23 kDa protein containing a C-terminal death domain homologous to the death domains of APO-1 and the type 1 TNF receptor (Chinnaiyan et al, 1995). The human FADD gene (3.6 kb, two exons maps to chromosome 11q13.3 (Kim et al, 1996).
The death domain of FADD interacts with the intracellular death domain of the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |