Dermadistinctin-L |
Dermadistinctin-Q2 |
D-Factor |
||
This peptide [ALWKNMLKGIGKLAGQAALGAVKTLVGAES] belongs to the family of antimicrobial peptides known as dermaseptins. It has been isolated from Phyllomedusa distincta (Monkey frog) The peptide is active against Staphylococcus aureus, Enterococcus faecalis, Pseudomonas aeruginosa, and E.coli. It is active also against Trypanosoma cruzi (Batista et al, 1999).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |