DRATHGGE |
DRCC1 |
KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG |
||
DRAXIN [dorsal repulsive axon guidance protein; dorsal inhibitory axon guidance protein] is the approved gene symbol. This protein has been described independently as neucrin. The human protein is encoded by open reading frame C1orf187 [chromosome 1 open reading frame 187].
DRAXIN is a secreted protein that has been identified as a chemorepulsive axon guidance protein by Islam et al (2009). DRAXIN inhibits or repels neurite outgrowth from dorsal spinal cord and cortical explants in vitro. Ectopically expressed draxin inhibits growth or causes misrouting of chick spinal cord commissural axons in vivo. DRAXIN
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |