BigLEN |
Big NERP-2 |
GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS |
||
approved gene symbol: BGN. In the older literature this protein is being referred to as PG-S1 [Bone/cartilage proteoglycan 1; bone small proteoglycan 1, small proteoglycan 1] (Fisher et al, 1989), DSPG1 [dermatan sulfate proteoglycan-1] (Thomas et al, 1991). The protein was isolated originally as PG I [Proteoglycan-1]. The protein has been identified independently as AILE22 [augmented expression in SLE 22].
Biglycan is a highly conserved small cellular or pericellular matrix chondroitin sulfate / dermatan sulfate proteoglycan that is expressed widely in the extracellular matrix
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |