Alo-2 |
alopecia and excoriation |
GPR48 |
||
An antifungal peptide (CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK) isolated from the coleopteran Acrocinus longimanus (Giant harlequin beetle). The peptide is found in hemolymph and is active against the Candida glabrata yeast strain (Barbault et al, 2003).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |