Acronymania |
AcSDKP |
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYL |
||
[adipocyte complement related protein of 30 kDa] (30 kDa adipocyte complement-related protein). The gene symbol is ADIPOQ [adiponectin, C1q and collagen domain containing].
This protein is produced exclusively in adipocytes (see also: adipokines). Its mRNA is induced over 100-fold during differentiation of adipocytes. Acrp30 is structurally similar to complement factor C1q and to a hibernation-specific protein isolated from the plasma of Siberian chipmunks. The protein forms large homo-oligomers that undergo a series of post-translational modifications (Scherer et al, 1995).
Secretion of Acrp30 is enhanced by insulin, and Acrp30 is an abundant serum
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |