lumbricin-1(6-34) |
Lumbricusin |
NSPL2 |
||
lumbricin-PG [FSRYARMRDSRPWSDRKNNYSGPQFTYPPEKAPPEKLIKWNNEGSPIFEMPAEGGHIEP] is an antimicrobial peptide resembling lumbricin-1 from the earthworm Lumbricus rubellus. It has been isolated from skin secretions of the earthworm, Pheretima guillelmi (Michaelsen) (Li et al, 2011).
Purified lumbricin-PG shows potent antimicrobial activities against bacteria and fungi. It is weakly hemolytic for human and rabbit red cells.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |