Longicin P4 peptide |
Long intergenic non-coding RNAs |
PCPV(VR634)VEGF |
||
This antimicrobial peptide (DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG) that resembles defensins has been isolated from the salivary glands of the hard tick, Haemaphysalis longicornis (Lu et al, 2010). Longicornsin shows potent antimicrobial activities against bacteria and fungi. It shows strong antimicrobial ability against drug-resistant microorganisms and Helicobacter pylori.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |