COPE Media Kit

Cope Home
Previous entry:
VGlut3 amacrine cells
Next entry:
Random entry:
lipopolysaccharide receptor
Search COPE:


This peptide with the sequence VSCNGVCSPFEMPPCGSSACRCIPYGLVVGNCRHPSG has been isolated from germinating pea seed extracts of peas (Pisum sativum).

Jiang H et al (2015) have reported that Vglycin promotes the proliferation of pancreatic Beta-cells and suppresses apoptosis and dedifferentiation of these cells. It promotes the restoration of Beta-cells in both young streptozotocin-induced type 1 diabetic SD rats and in aged high-fat diet with (or without) stretozotocin-induced type 2 diabetic C57BL/6 mice. This is accompanied by activating the insulin receptor and corresponding transcription factors. Impaired insulin sensitivity and glucose tolerance in aged T2DM mice ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=53182