VSGP |
VSIG9 |
MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG |
||
[V-set and immunoglobulin domain containing 3] The approved gene symbol is IGSF11 [immunoglobulin superfamily member 11]. The gene has been cloned by Suzu et al (2002) who referred to it as Bt-IgSF [Brain and testis-specific immunoglobulin superfamily protein], showing that the gene is expressed preferentially in both brain and testis.
Harada H et al (2005) have reported that VSIG3 is a transmembrane Ig-like cell adhesion molecule that functions as a cell adhesion molecule through homotypic interactions between neighboring cells. The authors have suggested a role of cell surface VSIG3 in the development/function of the central nervous system and spermatogenesis.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |