VLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK |
VLLSPLSVATALSALSLGAEQRTES |
defensin-beta-10 |
||
VLL-28 peptide (VLLVTLTRLHQRGVIYRKWRHFSGRKYR) is a cryptic peptide contain within the sequence of Stf76 protein, a transcription factor encoded by pSSVx, a hybrid plasmid-virus from the archaeon Sulfolobus islandicus (Contursi P et al, 2014).
Notomista E et al (2015) have reported that VLL-28 displays chemical, physical, and functional properties typical of cationic antimicrobial peptides and possesses broad-spectrum antibacterial activity.
VLL-28 is active against Gram-positive bacteria and Gram-negative bacteria including some clinically relevant strains, such as Pseudomonas aeruginosa and Staphylococcus aureus, and is active also against Candida albicans. In Escherichia coli, the activity of VLL-28 is comparable to that of GKY20
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |