VLGGGSALLRSIPA |
VLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK |
CCS-3 |
||
[vertebrate lonesome kinase] the approved gene symbol is PKDCC [protein kinase domain containing, cytoplasmic]. The kinase has been referred to as ADTK1 [Anterior Distal Tyrosine Kinase 1] in mice (Gonçalves et al, 2011).
This protein kinase, which has no homologs outside of the vertebrate lineage, has been identified by Kinoshita et al (2009). Expression is newly induced upon differentiation of mouse embryonic stem cells to mesendoderm. VLK is first expressed in anterior visceral endoderm and mesendoderm by cells expressing E-cadherin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |