US2 |
US3PK |
DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC |
||
This is one of the two protein kinases encoded by human herpesvirus (US3PK [US3 protein kinase]) (Purves et al, 1987). Unlike the second protein kinase, UL13, the US3 serine/threonine protein kinase (also abbr. US3PK) is not packaged into the virion. The serine/threonine kinase encoded by the US3 gene is conserved among all known alphaherpesviruses, including Varicella zoster virus US3 kinase (Varicella zoster virus ORF66 protein) (Stevenson et al, 1994; McGeoch and Davison, 1986; Erazo and Kinchington, 2010), Herpes simplex virus US3 protein (HSV-1 and HSV-2 (McGeoch and Davison, 1986), Bovine herpesvirus US3 protein (Bovine herpesvirus orf 3 protein) (Takashima et al, 1999; Leung-Tack et al, 1994),
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |