COPE Media Kit


Cope Home
Previous entry:
Opistoporin-2
Next entry:
Opl cells
Random entry:
Signal sequence
Search COPE:

Opistoporins

Opistoporin-1 (GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS) and Opistoporin-2 (GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS) are pore-forming peptides isolated from the venom of the South-African scorpion Opistophtalmus carinatus. These two alpha-helical, cationic peptides differ by only one amino acid. Opistoporin-1 is very active in inhibiting growth of Gram-negative bacteria and also has antifungal activities. Opistoporin-1 possesses hemolytic activity for erythrocytes (Moerman et al, 2002). Elgar et al (2006) have shown that the peptide induces pore formation in cardiac myocytes.

Moerman et al (2003) have reported that the ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2006



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=38167