Opistoporin-2 |
Opl cells |
Signal sequence |
||
Opistoporin-1 (GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS) and Opistoporin-2 (GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS) are pore-forming peptides isolated from the venom of the South-African scorpion Opistophtalmus carinatus. These two alpha-helical, cationic peptides differ by only one amino acid. Opistoporin-1 is very active in inhibiting growth of Gram-negative bacteria and also has antifungal activities. Opistoporin-1 possesses hemolytic activity for erythrocytes (Moerman et al, 2002). Elgar et al (2006) have shown that the peptide induces pore formation in cardiac myocytes.
Moerman et al (2003) have reported that the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |