MACF |
MACH |
VSCNGVCSPFEMPPCGSSACRCIPYGLVVGNCRHPSG |
||
[microtubule-actin cross-linking factor-1] Another designation is MACF.
This protein is known also macrophin 1 (Okuda et al, 1999), ACF7 [Actin cross-linking factor-7] (Kodama et al, 2003; Bernier et al, 1996), trabeculin-alpha (Sun et al, 1999). The human MACF1 gene contains at least 102 exons and spans more than 270 kb (Gong et al, 2001).
The protein belongs to the family of cytoskeletal cross-linking proteins known as spectraplakins (Röper et al, 2002) and possesses domains engaged in binding actin and microtubules. MACF1 is important for cellular polarization
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |