LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL |
LSECs |
FLPAIAGMAAKFLPKIFCAISKKC |
||
This peptide corresponds to Pepcan-21 [peptide endocannabinoid 21], a member of a peptide family whose members are derived from Hemoglobin-alpha. See: Pepcans [peptide endocannabinoids]
See also cryptides for bioactive fragments of parent proteins. For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |