Gal-alpha-1-4-Gal-beta-1-4-Glc-beta-1-1-Ceramide |
galanin(1-12) |
IL23 |
||
abbr. GLNN, GALN, GAL. This amidated peptide (GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS) is expressed widely in the peripheral and central nervous system (Schmidt et al, 1991). The human gene has been cloned by Evans et al (1993) and yields a protein of 30 amino acids. The proprotein was named galanin after its N-terminal glycine and its C-terminal alanine. For a second peptide originating from the same prepropeptide as galanin see: galanin message-associated peptide (GMAP).
Galanin is a neurohormone that stimulates secretion of Luteinizing hormone from dispersed anterior pituitary cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |