GNCP-1A |
GNFS-60 |
slie |
||
[guinea pig neutrophil cationic peptide-2] a small cationic peptide, RCICTTRTCRFPYRRLGTCLFQNRVYTFCC, found in guinea pig neutrophils. The sequence shows high identity with another peptide, GNCP-1, which is encoded by a homologous but different gene.
The peptide belongs to the Alpha-Defensins and has been shown to be active against Escherichia coli and Staphylococcus aureus (Yamashita and Saito, 1989). It also has antiviral and antifungal activity (Selsted and Harwig, 1987). It also releases histamine from rat mast cells (Yamashita and Saito, 1989).
For other proteins/peptides with functions in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |