Fallaxidins |
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
macrocortin |
||
This C-terminally alpha-amidated peptide of 25 amino acids (GVVDILKGAAKDIAGHLASKVMNKLamide) with antimicrobial activity has been isolated from skin secretions of the mountain chicken frog Leptodactylus fallax (Anura: Leptodactylidae) (Rollins-Smith et al, 2005). The peptide has been isolated also from the skin secretion of Leptodactylus labyrinthicus (Cunha Neto et al, 2015).
The peptide is structurally similar to members of the ranatuerin-2 family. Nielsen et al (2007) have reported structure-activity studies of fallaxin based on 65 analogs.
Fallaxin inhibits the growth of Gram-negative bacteria (Escherichia coli
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |