COPE Media Kit


Cope Home
Previous entry:
Fallaxidins
Next entry:
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Random entry:
MAP97
Search COPE:

Fallaxin

This C-terminally alpha-amidated peptide of 25 amino acids (GVVDILKGAAKDIAGHLASKVMNKLamide) with antimicrobial activity has been isolated from skin secretions of the mountain chicken frog Leptodactylus fallax (Anura: Leptodactylidae) (Rollins-Smith et al, 2005). The peptide has been isolated also from the skin secretion of Leptodactylus labyrinthicus (Cunha Neto et al, 2015).

The peptide is structurally similar to members of the ranatuerin-2 family. Nielsen et al (2007) have reported structure-activity studies of fallaxin based on 65 analogs.

Fallaxin inhibits the growth of Gram-negative bacteria (Escherichia coli ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: February 2017



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=18295