COPE Media Kit


Cope Home
Previous entry:
fa
Next entry:
Fa-AMP1
Random entry:
PDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
Search COPE:

FA-1

[Fetal antigen-1] This glycoprotein has been isolated from Mus musculus amniotic fluid (Krogh et al, 1997). It is the circulating form of human dlk, which is obtained by proteolytic processing of the membrane-bound parent protein (Krogh et al, 1997). The protein has been described independently as Pref-1, pG2, and delta-like.

A circulating form of FA-1 has been isolated from human amniotic fluid during the second trimester of pregnancy. The protein is found in placental villi (Jensen et al, 1994). These authors also reported that FA-1 is found together with insulin in insulin secretory granules of pancreatic beta-cells. They also identified FA-1 expression in 10 of 14 neuroendocrine lung tumors.

Floridon et al (2000) have suggested that FA-1 is a ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: January 2008



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=18212