fa |
Fa-AMP1 |
PDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE |
||
[Fetal antigen-1] This glycoprotein has been isolated from Mus musculus amniotic fluid (Krogh et al, 1997). It is the circulating form of human dlk, which is obtained by proteolytic processing of the membrane-bound parent protein (Krogh et al, 1997). The protein has been described independently as Pref-1, pG2, and delta-like.
A circulating form of FA-1 has been isolated from human amniotic fluid during the second trimester of pregnancy. The protein is found in placental villi (Jensen et al, 1994). These authors also reported that FA-1 is found together with insulin in insulin secretory granules of pancreatic beta-cells. They also identified FA-1 expression in 10 of 14 neuroendocrine lung tumors.
Floridon et al (2000) have suggested that FA-1 is a
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |