dlp |
DLPKINRKGP-bradykinin |
family with sequence similarity 19 member A4 |
||
[defensin-like peptide 4] This antimicrobial peptide, ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK, from the hemolymph of Hermetia illucens (black soldier fly) larvae belong to the family of defensins and is active against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |