BIR-2 |
BIRC1 |
MLKLIFLHRLKRMRKRLKRKLRLWHRKRYK |
||
[baculoviral IAP repeat-containing protein]. See: IAP. This family of proteins contains proteins with a BIR domain. Members are BIRC1, BIRC2, BIRC3, BIRC4, BIRC5, BIRC6, BIRC7, BIRC8.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |