APEL |
Apelin |
CHOP-10 |
||
(approved gene symbol) [Apelin receptor early endogenous ligand] The APELA gene has been shown to encode a short, conserved, and secreted peptide (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP). Miura et al (2004) and Chng SC et al (2013) have reported that the expression of APELA is most highly expressed in undifferentiated embryonic stem cell and is downregulated rapidly during human embryonic stem cell differentiation.
Perjés et al (2016) have reported that APELA is expressed predominantly in the adult rodent heart in cell types other than cardiomyocytes and binds to apelin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |