tabimmunregulin 12 |
Tabinhibitin 1 |
Activin receptor-like kinase 3 |
||
Tabimmunregulins are a family of 12 peptides from the salivary gland of the horsefly Tabanus yao (Diptera, Tabanidae) (Xu et al, 2008). These peptides are encoded in the C-terminal end of a longer precursor protein.
At least two of these peptides, tabimmunregulin 1 (GGVSGVSDFEPIEVFGEDYDSDEADEDGKG), and tabimmunregulin 12 (GGVSGVGDYKPIVVFGKSFNQFEAAEGAKG have been shown to possess immunosuppressive activities, increasing the production of IL10 in mouse splenocytes and decreasing the secretion of pro-inflammatory IFN-gamma in response to LPS. The peptides
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base