COPE Media Kit


Cope Home
Previous entry:
gp120
Next entry:
gp120 F peptide
Random entry:
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
Search COPE:

gp120 binding protein

[HIV gp120 binding protein] The gene encoding this protein has been cloned by Curtis et al (1992). gp120 binding protein is a membrane-associated mannose-binding lectin of 404 amino acids that is unrelated to CD4. The protein binds gp120 with high affinity and effects rapid internalization of the viral protein. Binding is inhibited by mannan, D-mannose, and L-fucose. Geijtenbeek et al (2000) have suggested that this binding protein, which does not initiate infection of cells by HIV, nevertheless plays an important role in viral infections. The protein is expressed abundantly on dendritic cells (see also: DC-SIGN) that may have bound the virus in the periphery. Since dendritic cells migrate to secondary lymphoid organs, which are rich in ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

Entry completed



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=21837