gastric foveolar mucous cells |
gastric inhibitory peptide(7-42) |
ten-cysteine protein 1 |
||
abbr. and approved gene symbol: GIP (a term with multiple meanings). Also: gastric inhibitory polypeptide. This name has been given by Brown and Dryburgh (1971) to a peptide isolated from intestinal mucosa. The peptide, YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, was named thus because exogenous administration inhibits gastric acid secretion and gastrointestinal motility in dogs. Following the discovery that this peptide also possesses insulinotropic properties and thus acts as an incretin, the new name glucose-dependent insulinotropic peptide (glucose-dependent insulinotropic polypeptide; same acronym: GIP
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |