family with sequence similarity 26 member F |
family with sequence similarity 61 member A |
GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC |
||
abbr. and approved gene symbol: FAM32A. See: OTAG-12 [ovarian tumor-associated gene 12]
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |