COPE Media Kit


Cope Home
Previous entry:
Entamoeba histolytica cysteine proteinase-5
Next entry:
enteric glial cells
Random entry:
aspecific opsonin
Search COPE:

enteric beta-Defensin

abbr. EBD. This bovine peptide, NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR, is a member of the family of Beta-Defensins. Enteric beta-Defensin mRNA is expressed highly in the distal small intestine and colon, anatomic locations distinct from those for previously characterized Beta-Defensins. Enteric beta-Defensin mRNA localizes to epithelial cells of the colon and small intestinal crypts and its expression is upregulated in response to infection with the intestinal parasite Cryptosporidium parvum, suggesting that enteric beta-Defensin may contribute to host defense of enteric mucosa (Tarver et al, 1998).

Mackenzie-Dyck S (2011) have reported that the peptide is chemotactic for immature bovine ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2015



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=17251