Entamoeba histolytica cysteine proteinase-5 |
enteric glial cells |
TNFSF19 |
||
abbr. EBD. This bovine peptide, NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR, is a member of the family of Beta-Defensins. Enteric beta-Defensin mRNA is expressed highly in the distal small intestine and colon, anatomic locations distinct from those for previously characterized Beta-Defensins. Enteric beta-Defensin mRNA localizes to epithelial cells of the colon and small intestinal crypts and its expression is upregulated in response to infection with the intestinal parasite Cryptosporidium parvum, suggesting that enteric beta-Defensin may contribute to host defense of enteric mucosa (Tarver et al, 1998).
Mackenzie-Dyck S (2011) have reported that the peptide is chemotactic for immature bovine
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |