bullfrog pepsinogen A-derived antimicrobial peptide |
bullous pemphigoid antigen 1 |
Klotho-lactase-phlorizin hydrolase-related protein |
||
abbr. bPcAP. A strong antimicrobial activity against a broad spectrum of microorganisms has been isolated from the stomach of the bullfrog, Rana catesbeiana. This peptide (IIKVPLKKFKSMRDVMRHEGIKAPVVHPATKY) is derived from the N-terminal sequences of pepsinogen C prosequence. The peptide may act as a defense peptide that contributes to the antimicrobial function of the gastrointestinal mucosa of vertebrates, including humans.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |