atrial natriuretic peptide[103-125] |
Atrial natriuretic peptide receptor 1 |
EMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQC |
||
abbr. ANPRC. This is another designation for NPR-C [natriuretic peptide receptor-C]. See NPR3 [natriuretic peptide receptor 3], which is the approved gene symbol.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |