alpha-s2-casein(189-192) |
alpha-s2-casein(198-202) |
MSKLVQAISDAVQAGQNQDWAKLGTSIVGIVENGVGILGKLFGF |
||
Also: casein-alpha-s2(190-197). This short peptide with the sequence MKPWIQPK (Met-Lys-Pro-Trp-Ile-Gln-Pro-Lys) is derived from alpha-s2-casein (approved gene symbol: CSN1S2; casein-alpha-s2; Alpha-s2-casein). It has been shown to act as an inhibitor of angiotensin-1 converting enzyme (CD143) and can lower blood pressure in rats (Maeno et al, 1996). See also cryptides
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base