Vaccinia virus late transcription factor 4 |
Vaccinia virus M2L protein |
VTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR |
||
This protein encoded in the genome of Vaccinia virus is encoded by an early gene that is transcriptionally silent late in infection. M1L is absent in the attenuated MVA strain of Vaccinia virus, a strain that stimulates cell death by apoptosis in several types of immune cells. Ryerson et al (2017) have reported that M1L acts as an inhibitor of cell death by apoptosis.
Expression of ML1 increases the viability of MVA-infected THP-1 cells and Jurkat cells and reduces several biochemical hallmarks of apoptosis such as PARP1 and cleavage of the proform of caspase-3. Ectopic M1L
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |