COPE Media Kit


Cope Home
Previous entry:
VPREB1
Next entry:
VPS24
Random entry:
ALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS
Search COPE:

V proteins

[V protein]

V proteins are encoded in the genomes of many members of the paramyxovirus family of negative-strand RNA viruses. Genera belonging to this family include Respirovirus (e. g., Sendai virus), Rubulavirus (e. g., parainfluenza virus, mumps virus), Avulavirus (e. g., Newcastle disease virus), Morbillivirus (e. g., measles virus, Canine distemper virus), and henipaviruses (e. g., Hendra virus, Nipah virus). V proteins are encoded by the V/P gene, which encodes two mRNA species encoding two viral proteins, V and P, whose N termini are identical (Thomas et al, 1988).

Paramyxovirus V proteins show noticeable sequence divergence but contain a highly conserved C-terminal cysteine-rich domain ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: October 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=53598