VPREB1 |
VPS24 |
ALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS |
||
[V protein]
V proteins are encoded in the genomes of many members of the paramyxovirus family of negative-strand RNA viruses. Genera belonging to this family include Respirovirus (e. g., Sendai virus), Rubulavirus (e. g., parainfluenza virus, mumps virus), Avulavirus (e. g., Newcastle disease virus), Morbillivirus (e. g., measles virus, Canine distemper virus), and henipaviruses (e. g., Hendra virus, Nipah virus). V proteins are encoded by the V/P gene, which encodes two mRNA species encoding two viral proteins, V and P, whose N termini are identical (Thomas et al, 1988).
Paramyxovirus V proteins show noticeable sequence divergence but contain a highly conserved C-terminal cysteine-rich domain
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |