Tanapoxvirus 15L protein |
Tanapoxvirus IFN-gamma/IL2/IL5 binding protein |
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR |
||
This glycoprotein is secreted by cells infected with Tanapoxvirus. The protein binds to human IFN-gamma, IL2 and IL5 and inhibits their bioactivity (viral IFN-gamma/IL2/IL5 binding protein). The protein does not bind to IL1-alpha, IL3, IL4, IL6, IL7, IL8 or IL10. Note that Tanapoxvirus 2L protein is sometimes being referred to as glycoprotein gp38 but appears to be different from Tanapoxvirus 38 kDa protein.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |