Tpr |
TPRPVCAATCDCKIITGTKCPPGYEK |
SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
||
[TPR domains]
[tetratricopeptide repeat] This domain was identified originally in yeast as a protein-protein interaction motif in cell cycle proteins. The domain is found in more than 800 different proteins from bacteria and humans (Scheufler et al, 2000).
The TPR domain is a degenerate sequence of approximately 34 amino acids loosely based around the consensus residues W-LG-Y-A-F-A-P, which appears in tandem. Proteins containing this domain appear to act as scaffolds for the assembly of different multiprotein complexes, which include the anaphase promoting complex, the peroxisomal import receptor, and the NADPH oxidase complexes (Alan and Ratajczak, 2011).
For information on other protein domains and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |