TNF ligand-related molecule 1 |
TNF ligand superfamily member 1 |
ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
[tumor necrosis factor ligand superfamily] Also designated TNFL superfamily. Members of this family are distantly related to TNF but do not show a high degree of sequence homology. They share a number of other features. Members of this protein family have some common biological activities, but some activities are shared by only some ligands, while others are unique.
Most ligands are type 2 transmembrane proteins (extracellular C-terminus) with a short cytoplasmic segment (10-80 amino acids) and a much longer extracellular region (140-215 amino acids). The proteins usually form trimeric structures. The monomers are composed of beta-strands that orient themselves into a two sheet structure.
A more systematic nomenclature for members of this family now uses the TNFSF (for
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |