COPE Media Kit


Cope Home
Previous entry:
TNF ligand-related molecule 1
Next entry:
TNF ligand superfamily member 1
Random entry:
ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Search COPE:

TNF ligand superfamily

[tumor necrosis factor ligand superfamily] Also designated TNFL superfamily. Members of this family are distantly related to TNF but do not show a high degree of sequence homology. They share a number of other features. Members of this protein family have some common biological activities, but some activities are shared by only some ligands, while others are unique.

Most ligands are type 2 transmembrane proteins (extracellular C-terminus) with a short cytoplasmic segment (10-80 amino acids) and a much longer extracellular region (140-215 amino acids). The proteins usually form trimeric structures. The monomers are composed of beta-strands that orient themselves into a two sheet structure.

A more systematic nomenclature for members of this family now uses the TNFSF (for ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2011



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=50196