TC26 |
TCA |
MRGX2 |
||
TC38 is an antimicrobial peptide (RNCMEVCVKGEKKHTGQGMIRRLRRNKNNSIFVVRKRV, corresponding to the C-terminus (residues191-228) of TFPI-2 [tissue factor pathway inhibitor-2] isolated from Half-smooth tongue sole (Cynoglossus semilaevis) (Zhao et al, 2016). The peptide has been shown to possess antibacterial activity against Micrococcus luteus.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |