myeloid-epithelial-reproductive tyrosine kinase |
Myeloid hematopoietic cells |
QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW |
||
abbr. MGF (a term with multiple meanings). Apart from the term being a general designation for any activity promoting the growth of myeloid cells, one particular activity has been shown to be identical with LIF [Leukemia inhibitory factor] (Moreau et al, 1988; Williams et al, 1988).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |