MSI1 |
MSI-78 |
AYVLDEPKPIKDLEKSLQHNLVYCRRLVLEYFLKSIFEYH |
||
[musashi homolog 2; Musashi-2; musashi RNA-binding protein 2] Like the closely related MSI1, MIS2 is an evolutionarily conserved mammalian homolog of the Drosophila melanogaster neural RNA-binding protein Msi [Musashi], which is expressed predominantly in neuroblasts / neurons during embryogenesis and is required for development of adult external sensory organs (sensilla) (Nakamura M et al, 1994). The mouse MSI2 gene, which encodes an poly(U) RNA binding protein expressed in neural precursor cells and subpopulations of neurons in the mammalian CNS, has been cloned
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |