MLGYNFSSFPCGTISIAPGFFNFYRLYFIWVNGLAKVVW |
ML-IC |
CD28LG2 |
||
[melanoma inhibitor of apoptosis]. This human protein contains a single BIR domain and RING finger motif. The protein has been renamed BIRC7 [baculoviral IAP repeat-containing protein-7]. See: IAP (inhibitor of apoptosis). The protein has been described independently also as Livin and KIAP.
ML-IAP is expressed in a number of embryonic tissues and tumor cell lines. The majority of melanoma cell lines but not primary melanocytes express this protein and are significantly more resistant to apoptotic stimuli (Vucic et al, 2000).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |