Meltrin-epsilon |
MEM-133 |
GVFDIIKGAGKQLIAHAMEKIAEKVGLNKDGN |
||
The monoclonal antibody MEM-102 (Bazil et al, 1989) is directed against a human leukocyte cell surface antigen, identified as a glycoprotein of 40 kDa anchored in membrane through a phosphatidylinositol moiety. MEM-102 antigen is expressed on all peripheral blood lymphocytes, both resting and activated. Its properties are very similar to a previously described activation antigen, Blast-1 and Korinek et al (1991) have reported that the two antigens are identical.
In the nomenclature of CD antigens this protein has been given the designation CD48.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |