MCT-ATP6 |
MCTC mast cells |
GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK |
||
[mitocryptide-ATP8]. This peptide, Formyl-MPQLNTTVWPT, is a so-called mitocryptide (see also: cryptides). The peptide is derived from the N-terminus of the parent protein, which is a subunit of mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) known as F-ATPase subunit 8 encoded by gene MT-ATP8 [ATP synthase protein 8]. Unlike some other mitocryptides, the peptide does not cause cell activation of neutrophils, does not activate the neutrophil NADPH oxidase system, does not trigger superoxide release, and does not act as an agonist or antagonist for formyl peptide receptors
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |