Killer cell immunoglobulin-like receptor 2DS1 |
Killer cell immunoglobulin-like receptor 2DS3 |
LYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
||
see: KIR2DS2, which is the approved gene symbol. In the nomenclature of CD antigens this protein has been given the designation CD158j. See: CD158.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |